antlytics.com valid
Antlytics
Antlytics is privacy-friendly web analytics for developers, indie hackers, and agencies who run multiple websites. Switch between sites instantly in one dashboard, then get structured “what happened / what to do next” without inventing your own reporting stack. Free plan: one site, Overview/Pages/Referrers, hard monthly pageview caps, no credit card. Starter from US$9/month: unlimited sites, full dashboard (UTMs, goals, funnels, realtime), soft fair-use with no dashboard lockout. Pro adds AI Pag
For agents: Privacy-friendly web analytics for developers and agencies running multiple sites; free and paid plans, MCP setup, REST API with OpenAPI spec.
web analyticsprivacy analyticspageviewsreferrersmcp serverrest api
- Authority
- 46 reach 0 · trust 6 · quality 25 · freshness 15
- Tier
- listed
- llms.txt
- https://www.antlytics.com/llms.txt
- llms-full.txt
- https://www.antlytics.com/llms-full.txt
- Sections
- 16
- Links
- 209
- Size
- 40674 bytes
- Registered
- 2026-03-17
- Country
- United States Hosting inference
- Hosting country
- United States Hosting inference
- Country evidence
- No published address evidence collected yet
- Categories
- Data and analytics
- For agents
- Interface: a documented API or declared MCP endpoint an agent can call
- Inferred actions
- Read documentation Call an API Search content About these labels
- Audience
- developers · agents can: read docs, call api, search content · en
- First seen
- 2026-10-26T08:59:34.195Z
- Last checked
- 2026-10-26T08:59:37.298Z
- Badge
Their llms.txt
The beginning of the file, from our validated copy saved 2026-10-26T08:59:34.199Z. Cached copy · Source on antlytics.com
# Antlytics
> Antlytics is privacy-friendly web analytics for developers, indie hackers, and agencies who run multiple websites. Switch between sites instantly in one dashboard, then get structured “what happened / what to do next” without inventing your own reporting stack. Free plan: one site, Overview/Pages/Referrers, hard monthly pageview caps, no credit card. Starter from US$9/month: unlimited sites, full dashboard (UTMs, goals, funnels, realtime), soft fair-use with no dashboard lockout. Pro adds AI Page Insights with your own LLM key, fuller MCP tools, and shield rules. Install with npx @antlytics/init, a script snippet, or framework SDKs (Next.js, Nuxt, SvelteKit, Astro).
Product story:
- All your sites, one switch: Add SaaS apps, client sites, and side projects. Switch between them instantly in one dashboard.
- Structure without the grind: Skip inventing events, reports, and a narrative from raw charts. Report mode turns Overview into readable markdown.
- Clear next steps: On Pro, AI Page Insights use your LLM key to surface observations and recommendations for any page.
Key facts:
- Category: privacy-friendly multi-site web analytics / Google Analytics alternative
- Positioning: Multi-site analytics that tells you what to do next — switch sites instantly and get structured next steps without building a reporting stack. Free with no card; Starter from US$9 for unlimited sites
- Free: 1 site, Overview/Pages/Referrers, 25k pageviews/month hard, 30-day history, 6-month retention
- Install: `npx @antlytics/init` (auto-detects framework) or a script snippet
- Pro: AI Page Insights (BYOK), fuller MCP tools, shield rules
- MCP server for Claude/Cursor/ChatGPT (paid): https://www.antlytics.com/mcp
- REST OpenAPI (paid): https://www.antlytics.com/openapi.json
- No cookie banner required for typical analytics: no tracking cookies, no fingerprinting, no personal data of visitors
- Paid fair-use: email alerts, no dashboard lockout, no metered overage charges
## Main pages
- [Home](https://www.antlytics.com/): product overview, pricing, and FAQ
- [Live demo](https://www.antlytics.com/demo): explorable dashboard with sample data
- [Compare](https://www.antlytics.com/compare): Antlytics vs Google Analytics, Plausible, Umami, Fathom
- [Plans & limits](https://www.antlytics.com/docs/plans-and-limits): Free vs Starter vs Pro
- [MCP docs](https://www.antlytics.com/docs/mcp): connect Claude, Cursor, or ChatGPT (paid)
- [Site reports](https://www.antlytics.com/docs/site-reports): LLM-readable markdown from Overview (paid)
- [Bot filtering](https://www.antlytics.com/docs/bot-filtering): UA, spam referrer, datacenter IP, header filters; Shields stats
- [API reference](https://www.antlytics.com/docs/api-reference): REST API (paid)
- [OpenAPI spec](https://www.antlytics.com/openapi.json): machine-readable /api/v1 schema
- [Full LLM index](https://www.antlytics.com/llms-full.txt): complete documentation in one file
- [Changelog](https://www.antlytics.com/cha
…Related sites
Similar publisher descriptions and documentation. Similarity does not imply affiliation or equivalent capabilities.
| Domain | Title | Category | Country | Authority | llms.txt | llms-full.txt | Save |
|---|---|---|---|---|---|---|---|
| tinylytics.app | Tinylytics | interface Data and analytics | — | 56 | ✓ | ✓ | |
| ezstats.io | ezStats | interface AI and machine learning Data and analytics +1 | — | 45 | ✓ | ✓ | |
| getopen.so | Open Analytics | transactional Data and analytics | US | 48 | ✓ | ||
| seline.com | Seline is a website and product analytics platform for the modern web | transactional Data and analytics | PL | 52 | ✓ | ||
| withcabin.com | Cabin | documentation AI and machine learning Data and analytics +1 | IE | 59 | ✓ | ✓ | |
| aptabase.com | Aptabase | interface Data and analytics Developer tools | US | 60 | ✓ | ✓ | |
| wp-statistics.com | WP Statistics | transactional Data and analytics | — | 58 | ✓ | ||
| e-zeeinternet.com | e-ZeeInternet | interface Data and analytics APIs and SDKs | PL | 56 | ✓ |
Machine-readable: GET /v1/resolve?q=antlytics.com · GET /v1/domain/antlytics.com · this page as Accept: application/json or text/markdown · MCP lookup_domain
Automatically discovered from public files. Inclusion does not imply endorsement or publisher participation.
Own or manage this website?
If you own or manage antlytics.com, you can update its listing and review file health, discovery activity and score history.
Manage this listing — optional
What verification unlocks
See how your site is discovered—and control what agents see.
- See your website in the map
Review your indexed topics, nearby publishers sharing headings, measured listing exposure and map snapshots in a private report for your website.
- Control what agents see
Edit your listing description, tags, public contact details and additional llms.txt paths. Publish your terms for automated access, attribution and pricing.
- Make your profile eligible for search
A valid, listed, unblocked, verified profile can appear in our publisher sitemap and become eligible for search-engine visibility. Search engines decide what to index and rank.
- Appear in our llms-full.txt
Eligible verified publishers are listed by name, with their file links and summaries, in the service overview agents can read.
Free. No account registration, backlink or payment required. Public discovery remains available without verification.
Let your coding agent verify it
If your coding agent is authorized to manage this website, paste these instructions into it.
Claim my listing on Agent Web Map for antlytics.com:
1. POST https://agentwebmap.com/v1/sites/antlytics.com/claims and keep claim_id and claim_secret private.
2. Publish the verification line "AgentWebMap verification: <token>" (token from step 1) in https://antlytics.com/llms.txt, or use the DNS, meta-tag or well-known method the response describes. This only verifies the listing; your website and domain remain yours.
3. POST https://agentwebmap.com/v1/sites/antlytics.com/verify with {"claim_id": "...", "claim_secret": "..."}.
4. Save the api_key from the answer; it manages the listing (PATCH https://agentwebmap.com/v1/sites/antlytics.com).
MCP equivalent: tools begin_ownership_claim, then verify_domain, at https://agentwebmap.com/mcp. Docs: https://agentwebmap.com/docs#verifyCorrections or removal requests: contact the directory.